Patent Application Title |
Patent App Num. |
Date |
| Mucin antigen vaccine | 20130101626 | 20130425 | Provided are expression vectors for generating an immune response to a mucin. The vectors comprise a transcription unit encoding a secretable polypeptide, the polypeptide comprising a secretory signal, a mucin antigen and CD40 ligand. Also provided are methods of generating an immune response against cells expressing a mucin by administering an effective amount of the vector. Further provided are methods of generating an immune response against cancer cells expressing a mucin in an individual by administering an effective amount of the vector. Still further provided are methods of overcoming anergy to a mucin self antigen by administering an effective amount of the vector.
... | | Simultaneous inhibition of pd-l1/pd-l2 | 20130017199 | 20130117 | Methods and compositions for treating an infection or disease that results from (1) failure to elicit rapid T cell mediated responses, (2) induction of T cell exhaustion, T cell anergy or both, or (3) failure to activate monocytes, macrophages, dendritic cells and/or other APCs, for example, as required to kill intracellular pathogens. The method and compositions solve the problem of undesired T cell inhibition by simultaneously inhibiting the PD-1 ligands, PD-L1 and PD-L2. The immune response can be modulated by providing antagonists which bind with different affinity, by varying the dosage of agent which is administered, by intermittent dosing over a regime, and combinations thereof, that provides for dissociation of agent from the molecule to which it is bound prior to being administered again. In some... | | Anticancer agent comprising anti-pd-1 antibody or anti-pd-l1 antibody | 20120237522 | 20120920 | Provided is an anticancer agent which comprises an anti-PD-1 antibody or an anti-PD-L1 antibody as an active ingredient, functioning to reverse the unresponsiveness of iNKT cells in which anergy has been induced by administration with an iNKT cell ligand. The anti-PD-1 or anti-PD-L1 antibody blocks the PD-1/PD-L1-mediated signaling pathway not only to prevent the iNKT cell ligand-induced iNKT cell anergy, but also to reverse the unresponsiveness of already anergic iNKT cells to produce cytokines. In addition, the anti-PD1 or anti-PD-L1 antibody ensures the potent anti-tumor activity of iNKT cells as demonstrated by a significant reduction in the number of metastatic nodules in B16F10 melanoma metastasis models in vivo. Collectively, the anticancer agent can be very useful in the treatment of cancer, particularly metastatic cancer.
... | | Nanoparticle formulated glycolipid antigens for immunotherapy | 20120021050 | 20120126 | A composition for stimulating NKT cells to produce anti-cancer and anti-viral cytokines without causing anergy of NKT cells includes a glycolipid antigen and a nanoparticle conjugated with the glycolipid antigen. The glycolipid antigen and the nanoparticle are not antigenic in mouse and human being. The composition can further include covalent or non-covalent connection between the glycolipid antigen and the nanoparticle. The glycolipid antigen is alpha-galactosylceramide or an analog of that. The nanoparticle can be a polymer. A production method of the composition includes preparing a nanoparticle and a glycolipid antigen and loading the glycolipid antigen to the nanoparticle. The glycolipid antigen can be coated onto the surface of the nanoparticle or encapsulated within the nanoparticle. A method of stimulating NKT cells to produce anti-cancer and anti-viral... | | Peptides and apl-type derivatives of hsp60 and pharmaceutical compositions | 20100144642 | 20100610 | | Peptides of human heat shock protein of 60 kDa, that constitute epitopes for T cells, as well as their derived peptides, which are modified at the contact sites with the MHC molecule, are useful to induce mechanisms of peripheral tolerance, in particular mechanisms of anergy or mediated by clones of regulatory T cells in patients with Rheumatoid Arthritis. The invention also refers pharmaceutical compositions comprising such peptides for the treatment of Rheumatoid Arthritis.
... | Subscribe to updates on this page: Anergy RSS  | | Modulation of anergy and methods for isolating anergy-modulating compounds | 20100135910 | 20100603 | | The present invention provides methods for identifying compounds capable of modulating anergy by inhibiting the production or activity of anergy associated E3 ubiquitin ligases or by altering the interaction between a ligase and its substrate.
... | | Anticancer agent comprising anti-pd-1 antibody or anti-pd-l1 antibody | 20100086550 | 20100408 | | Provided is an anticancer agent which comprises an anti-PD-1 antibody or an anti-PD-L1 antibody as an active ingredient, functioning to reverse the unresponsiveness of iNKT cells in which anergy has been induced by administration with an iNKT cell ligand. The anti-PD-1 or anti-PD-L1 antibody blocks the PD-1/PD-L1-mediated signaling pathway not only to prevent the iNKT cell ligand-induced iNKT cell anergy, but also to reverse the unresponsiveness of already anergic iNKT cells to produce cytokines. In addition, the anti-PD1 or anti-PD-L1 antibody ensures the potent anti-tumor activity of iNKT cells as demonstrated by a significant reduction in the number of metastatic nodules in B16F10 melanoma metastasis models in vivo. Collectively, the anticancer agent can be very useful in the treatment of cancer, particularly metastatic cancer.
... | | Induction of tumor immunity by variants of folate binding protein | 20090227510 | 20090910 | | The present invention is directed to variants of antigens comprising folate binding protein epitopes as a composition associated with providing immunity against a tumor in an individual. The variant is effective in inducing cytotoxic T-lymphocytes but preferably not to the extent that they become sensitive to silencing by elimination, such as by apoptosis, or by anergy, as in unresponsiveness.
... | | Peptides and apl-type derivatives of hsp60 and pharmaceutical compositions | 20090171069 | 20090702 | | Peptides of human heat shock protein of 60 kDa, that constitute epitopes for T cells, as well as their derived peptides, which are modified at the contact sites with the MHC molecule, are useful to induce mechanisms of peripheral tolerance, in particular mechanisms of anergy or mediated by clones of regulatory T cells in patients with Rheumatoid Arthritis. The invention also refers pharmaceutical compositions comprising such peptides for the treatment of Rheumatoid Arthritis.
... | | Polypeptide complex that regulates cell cycle and anergy | 20090012017 | 20090108 | | An active ubiquitin E3 ligase, GRAIL, is crucial in the induction of anergy in cells of the immune system, and in the regulation of cellular proliferation. GRAIL is shown to associate with, and be regulated by Otubain isoforms, including OTUBAIN-1 (DOG, the Destabilizer of GRAIL) and an alternative reading frame splice variant of OTUBAIN-1 (SOG, the Stabilizer of GRAIL). These proteins play opposing roles in the regulation of GRAIL auto-ubiquitination and consequently on its ability to induce anergy and regulate cellular proliferation. DOG serves as an adaptor protein, recruiting the DUB USP8. One major substrate for USP8 is the Ras exchange factor Ras-GRF1, and this protein can be found in a complex with USP8 and GRAIL, which complex is ubiquitinated by GRAIL.
... | | Modulation of nkt cell activity with antigen-loaded cd1d molecules | 20080254045 | 20081016 | | The invention is directed to methods of modulating an immune response in an animal, comprising administering a composition comprising one or more soluble CD1d complexes, in particular non-specific soluble CD1d complexes. Soluble CD1d complexes comprise a soluble CD1d polypeptide, a β2-microglobulin polypeptide, and a ceramide-like glycolipid antigen bound to the CD1d antigen binding groove, and in certain embodiments, an immunogen. The administration of compositions of the present invention affects the activity of CD1d-restricted NKT cells, and in particular, allows for multiple administrations without causing CD1d-restricted NKT cell anergy.
... | | Use of cox-2 inhibitor to prevent t-cell anergy induced by dendritic cell therapy | 20080199484 | 20080821 | | The present invention relates to a method and combination therapy useful in the treatment of cancer. More specifically, the invention relates to the use of COX-2 inhibitors in combination with a therapeutic dendritic cell vaccine for treating cancer. The COX-2 inhibitors of the present invention are believed to inhibit the enzymatic activity of prostaglandineE2 (PGE2); thereby preventing COX-2 overexpressing tumors from evading immune surveillance by antigen-specific cytotoxic T lymphocytes (CTLs). COX-2 inhibitors are believed to suppress PGE2 that COX-2 overexpressing glioma produce, allowing tumor-infiltrating DCs to polarize Th cells toward Th-subset-1 (Th1).
... | | Device for feeding electrical energy from an anergy source | 20080192510 | 20080814 | | A device (1) for feeding electrical energy from an energy source with variable source voltage into an electric power supply network (15), said device (1) including a transformer (112) for galvanic isolation, a resonant inverter (11) with semi-conductor switches (a-d; A, B), one or several resonant capacitors (17; 18, 19; 20, 21) and one rectifier (113), is: intended to provide high efficiency and have galvanic isolation. This is achieved in that the resonant inverter (11) is operated in the full resonant mode if the operating voltage is in an operation point (MPP) and in the hard-switching mode if the voltages exceed the operation point (MPP).
... | Subscribe to updates on this page: Anergy RSS  | | Immunotherapy of epithelial tumors using intralesional injection of antigens that induce a delayed type hypersensitivity reaction | 20080193410 | 20080814 | | The pharmaceutical composition is useful for treating epithelial tumors in a subject and contains at least two antigens and a pharmaceutically acceptable carrier, where each of the antigens induces or is capable of inducing a cutaneous delayed type hypersensitivity (DTH) response in the subject. This composition is particularly useful in treating epithelial tumors, such as warts or verrucae, that are induced by or related to papillomavirus. Antigens useful in the present pharmaceutical composition are anergy panel antigens, such as killed mumps virus, candida extract, trichophyton extract or comparable antigenic extracts. An additional pharmaceutical composition, also useful for treating epithelial tumors, contains at least one antigen that induces or is capable of inducing a cutaneous DTH response in a subject, at least one cytokine or colony stimulating... | | Immunomodulatory peptides derived from heat shock proteins and uses thereof | 20080187550 | 20080807 | | A method of modulating an immune response in a subject is disclosed. The invention is based on the discovery that an effective therapeutic strategy for ameliorating the inflammation-related symptoms of an immune-mediated disease, such as arthritis, can be achieved by modulation of the underlying immune response itself, rather than by merely addressing the resulting inflammation. This strategy can be used to regulate the inflammatory response and is applicable to a variety of contexts in which immune modulation is desired, such as mucosal tolerization, DNA vaccination, anergy induction, active immunization, and ex vivo modulation of antigen-specific T cells. In one embodiment, the method comprises administering to the subject a bacterial dnaJ peptide or a human homolog or a non-homologous human isoform thereof.
... |
| Modulation of anergy and methods for isolating anergy-modulating compounds | 20070274915 | 20071129 | | The present invention provides methods for identifying compounds capable of modulating anergy by inhibiting the production or activity of anergy associated E3 ubiquitin ligases or by altering the interaction between a ligase and its substrate.
... | | Anergy-inducing cellular composition | 20070259329 | 20071108 | | The invention is directed to an anergy-inducing cellular composition comprising: cells having antigenic determinants on the cell surface and an anergy-inducing compound [e.g., (−)-epigallocatechin-3-o-gallate (EGCG)] attached by its chemical affinity to the antigenic determinants. In one embodiment, the anergy-inducing compound blocks co-stimulatory molecules among the antigenic determinants of the cells, which upon encountering with T-cell renders the latter anergic, that is, unresponsive toward alloantigens. In another embodiment, EGCG is of high purity for its efficient attachment to the antigenic determinants. The anergy-inducing cellular composition is prepared by immersing the cells in a culture media solution (RPMI 1640) containing 50-500 ppm EGCG at low physiological temperatures for one to two hours to minimize the cells' mortality. A specific use of the resulting anergic cellular composition is suggested,... | | Peptide constructs for treating autoimmune and related diseases | 20070128698 | 20070607 | | Conjugated peptides include a first peptide component which is an antigen associated with autoimmune disease, allergy, asthma or transplantation rejection and binds to an antigen-specific receptor on a T cell, and a second peptide component which corresponds to an “antigen presenting molecule” namely, a peptide binding to a T cell surface receptor, which would normally promote T cell activation when the first peptide is bound to its antigen-specific T cell receptor. However, in this invention, the second peptide component has an amino acid sequence which is a modification of an antigen presenting T cell binding peptide, such modification blocking or inhibiting the engagement of receptor sites on the T cell surface (other than the antigen-specific T cell receptor). As a result of the inhibition/blocking, T cell... | | Methods of preparation and composition of peptide constructs useful for treatment of autoimmune and transplant related host versus graft conditions | 20060257420 | 20061116 | | x is a direct bond or linker for covalently bonding P1 and P2.
... | | Substances | 20060165707 | 20060727 | | The present invention provides a multimers of class I Major Histocompatibility Complexes (MHCs) having a modified P2-microglobulin whose binding to CD8 is inhibited. Such MHCs are capable of inhibiting CD8+ T cell response, particularly by inducing apoptosis or anergy of the T cell. The invention also provides nucleic acids encoding such molecules, and the use of such multimers and nucleic acids in immunosuppressive therapy, in particular as inhibitors of cytotoxic T cell responses.
... | | Methods of preparation and composition of peptide constructs useful for treatment of autoimmune and transplant related host versus graft conditions | 20060088544 | 20060427 | | Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID... |
Other Directories (alphabetical): , , , , , , , , , , , , , , , , , , , , -
###
This listing is a sample listing of patents related to Anergy for is only meant as a recent sample of applications filed, not a comprehensive history. There may be associated servicemarks and trademarks related to these patents. Please check with patent attorney if you need further assistance or plan to use for business purposes. This patent data is also published to the public by the USPTO and available for free on their website. Note that there may be alternative spellings for Anergy with additional patents listed. Browse our RSS directory or Search for other possible listings.
|