Follow us on Twitter
twitter icon@FreshPatents


Adsorption patents

      

This page is updated frequently with new Adsorption-related patent applications.




 Helium recovery from streams containing helium, carbon dioxide, and at least one of nitrogen and methane patent thumbnailHelium recovery from streams containing helium, carbon dioxide, and at least one of nitrogen and methane
Systems and methods are provided for recovering helium from a feed comprising helium, carbon dioxide, and at least one of nitrogen and methane. The feed is separated in a first separator to form helium-enriched stream and a co2-enriched stream.
Air Products And Chemicals, Inc.


 Engine off vapor compression adsorption cycle patent thumbnailEngine off vapor compression adsorption cycle
A cooling system is disclosed so that an operator cabin can be cooled even if the engine is off. An accumulator can be used to store high-pressure refrigerant until its release.
Caterpillar Inc.


 Exhaust purifying system patent thumbnailExhaust purifying system
An exhaust purification system can prevent a nh3 slip caused by an excessive injection of urea water, and includes: an scr that purifies nox contained in an exhaust gas using ammonia, as a reducing agent, produced from urea water; a urea water injection device that injects the urea water into an exhaust passage upstream from the scr; an estimated-adsorption-amount calculation unit that calculates an estimated adsorption amount of the ammonia adsorbed in the scr; an injection control unit that executes an injection control of the urea water injection device based on the estimated adsorption amount; and an estimated-adsorption-amount change unit that changes the estimated adsorption amount used for the injection control into a value increased or decreased by a predetermined amount when a predetermined condition is established that can cause a difference between an actual adsorption amount of the ammonia adsorbed in the scr and the estimated adsorption amount.. .
Isuzu Motors Limited


 A novel affinity matrix and devices for isolation and purification of rna and dna for point of care molecular devices patent thumbnailA novel affinity matrix and devices for isolation and purification of rna and dna for point of care molecular devices
The present disclosure relates to nucleic acid extraction and purification methods and devices to accomplish the same. The present disclosure proposes a novel approach to this problem wherein cell isolation and nucleic acid purification can be integrated in a single “step,” by using the same solid phase for both cell adsorption and nucleic acid purification.
Accudx Corporation


 Rubber composition for use in tire treads patent thumbnailRubber composition for use in tire treads
A rubber composition comprises: per 100 parts by weight of a diene-based rubber, from 70 to 95 parts by weight of an inorganic filler containing two types of silicas, a silica x and a silica y, and a carbon black. A compounded amount of the silica x is x parts by weight and a compounded amount of the silica y is y parts by weight.
The Yokohama Rubber Co., Ltd.


 Rubber composition and tire obtained using same patent thumbnailRubber composition and tire obtained using same
Ctab adsorption specific surface area(m2/g)<230  (iii).. .

 A water reclamation method integrating magnetic resin adsorption and electrosorption patent thumbnailA water reclamation method integrating magnetic resin adsorption and electrosorption
A water reclamation method on the basis of integrated use of magnetic resin adsorption and electrosorption is provided. It belongs to the water reclamation field, including the following steps: pump the biotreated effluent into a reactor that is filled with magnetic resin particles so that the chromaticity, organic pollutants, total nitrogen, total phosphorus contained in the wastewater can be effectively reduced; channel the fully reacted mixture into a precipitation tank for separation; part of the separated magnetic resin is pumped back into the reactor while the rest of the separated magnetic resin flows into a regeneration tank; the wastewater treated by magnetic resin adsorption then flows into an electrosorption unit for a desalting process; the remaining organic pollutants and inorganic pollutants are further removed..
Est Water And Technologies Co., Ltd


 System for recovering multiple kinds of ions patent thumbnailSystem for recovering multiple kinds of ions
The present disclosure relates to a system for recovering multiple kinds of ions, which includes: an ion adsorption tank that includes a plurality of adsorption channels arranged in parallel and including a first electrode unit electrically adsorbing only negative ions and a second electrode unit having an adsorbent layer for adsorbing positive ions to be recovered from positive ions, in which electricity is independently supplied to the adsorption channels; a water tank that keeps liquid discharged from the ion adsorption tank; a pump that circulates mother liquor or liquid stored in the water tank; and an ion recovering tank that keeps liquid containing positive ions to be recovered. According to the present disclosure, a series of processes make it possible to continuously recover ions to be recovered, so the operation efficiency of the system can be maximized..
Korea Institute Of Geoscience And Mineral Resources (kigam)


 Coating rubber composition for conveyer belts patent thumbnailCoating rubber composition for conveyer belts
A coating rubber composition for a conveyer belt, comprising 15 to 75 parts by mass of carbon black having a nitrogen adsorption specific surface area of 50 m2/g or less, 25 to 100 parts by mass of calcium carbonate and 40 parts or less by mass of an oil per 100 parts by mass of blended rubber comprising of natural rubber and at least one of either butadiene rubber or sbr. The above coating rubber composition for conveyer belts can improve not only the peel force which is a criterion of adhesiveness with the canvas cloth but also the power-saving capability of the conveyer belt while maintaining the durability thereof.
The Yokohama Rubber Co., Ltd.


 Solid-phase carrier, production  solid-phase carrier, carrier for affinity refining, production  filler for affinity chromatography, filler for affinity chromatography, chromatography column, and refining method patent thumbnailSolid-phase carrier, production solid-phase carrier, carrier for affinity refining, production filler for affinity chromatography, filler for affinity chromatography, chromatography column, and refining method
There are provided a solid-phase carrier and a carrier for affinity refining that exhibit high dynamic binding capacity when a ligand is immobilized, have excellent antifouling properties, and are unlikely to have non-specific adsorption of impurities. The solid-phase carrier has a functional group capable of fixing a ligand and is characterized by having a group having a sulfinyl group, a sulfide group, an oxy group or an imino group, and a hydroxyl group, a thiol group, an amino group, a carboxy group, a sulfate group, a phosphate group or an alkanoyl group..
Jsr Life Sciences Corporation


Improved zeolite particles for adsorption and/or desorption of gases and liquids

Disclosed are silica bound zeolite adsorbent particles which possess high volumetric gas adsorption capacity for the adsorption and/or desorption of gases. The adsorbent are highly effective as a gas source in volumetrically constrained applications.
W. R. Grace & Co.-conn.

Ptp blister sheet, and ptp blister pack formed from same

To provide a ptp blister sheet exhibiting a high adsorption effect over prolonged periods, and a ptp blister pack formed from it. A ptp blister sheet having at least a gas barrier layer and an odor adsorption layer, wherein the odor adsorption layer comprises a heat-sealable resin containing an odor adsorption agent, and the odor adsorption agent is formed by a chemical adsorption agent supported on an inorganic porous body, and a ptp blister pack formed from it..
Dai Nippon Printing Co., Ltd.

Generator of transient, heavy electrons and application to transmuting radioactive fission products

Use of adsorption, desorption, particle injection and other means to excite electrons to a region on their band structure diagram near an inflection point were the transient effective mass is elevated proportional to the inverse of curvature. These transient heavy electrons may then cause transmutations similar to transmutations catalyzed by the muons used by alvarez at uc berkeley during 1956 in liquid hydrogen.
Tionesta Applied Research Corporation

Adsorption core and manufacturing method thereof

An adsorption core has (i) a heat medium tube in which a heat medium flows and (ii) an adsorption agent that adsorbs a fluid in a vapor phase outside of the heat medium tube when being cooled by the heat medium and desorbs the absorbed fluid when being heated. The heat medium tube has (i) a core member that is made of metal having a higher hardness with respect to copper and (ii) a covering layer that is made of copper and covers an outer surface of the core member.
Denso Corporation

Method for producing energy and apparatus therefor

A method for producing energy by exothermal reactions between hydrogen and a transition metal comprises a step 110 of depositing an amount of crystals of the transition metal in the form of micro/nanometric clusters having a predetermined crystalline structure on a surface of a substrate, wherein each clusters has a number of atoms of the transition metal lower than a predetermined number of atoms, and in such a way that the substrate contains on its surface a number of clusters that is larger than a minimum number. The method provide also performing at least once a start-up sequence is performed at least once a start-up sequence comprising the step 114 of quantitatively removing any gas adsorbed in the substrate and in the transition metal by applying a predetermined vacuum degree, a step 120 of bringing hydrogen into contact with the crystals, a step 130 of heating the crystals up to an adsorption temperature higher than a predetermined critical temperature, thus causing hydrogen adsorption to the crystals forming a reaction core, and a step of impulsively acting on the reaction core in order to trigger the exothermal reactions between the hydrogen and the transition metal in the clusters.

Exhaust gas control apparatus and exhaust gas control internal combustion engine

An exhaust gas control apparatus and method for an engine includes a urea water supply mechanism that adds urea water to exhaust gas, a scr catalyst that adsorbs ammonia and removes nox in the exhaust gas by using the adsorbed ammonia, and a control device that controls a urea water addition amount based on a target adsorption amount for the ammonia adsorbed onto the scr catalyst. The control device executes an integration processing that acquires a temperature of the scr catalyst at a predetermined cycle and integrates the acquired temperature of the scr catalyst when equal to or higher than a threshold, and an initialization processing that decreases the amount of the ammonia adsorbed on the scr catalyst on a condition that an integrated value of the temperature of the scr catalyst calculated in the integration processing has become equal to or higher than a predetermined value..
Toyota Jidosha Kabushiki Kaisha

Exhaust gas purification internal combustion engine

A three-way catalyst, an nsr catalyst, and an scr catalyst are provided in this order for an exhaust gas passage, wherein the air-fuel ratio (afr) is set to a first afr which is a rich afr before the afr is switched from a theoretical afr to a lean afr, and then the afr is set to a second afr which is higher than the first afr and lower than the theoretical afr if a nox occlusion amount is less than a threshold value during a period until an nh3 adsorption amount of the scr catalyst becomes a predetermined adsorption amount, while the afr is set to a third afr which is higher than the first afr and lower than the second afr if the nox occlusion amount is not less than the threshold value.. .
Toyota Jidosha Kabushiki Kaisha

A vapor deposition apparatus

Disclosed is a vapor deposition apparatus comprising an adsorption apparatus disposed in a vapor deposition cavity, wherein the adsorption apparatus comprising: a plurality of magnetic blocks arranged in a matrix disposed on a side of a substrate to be vapor deposited away from a metal mask plate, and a towing apparatus for adjusting each of the magnetic blocks to move up and down relative to the substrate to be vapor deposited. Such a vapor deposition apparatus may cause the metal mask plate to closely fit the substrate to be vapor deposited, such that a correct pattern will be formed when sub-pixel units are vapor deposited, and cause the magnetic fields of all the magnetic blocks to tend to be consistent, avoiding affecting the above-mentioned pattern by a deformation of the metal mask plate due to the inhomogeneity of the magnetic fields..
Boe Technology Group Co., Ltd.

Utilization of temperature heat adsorption skin temperature as scale control reagent driver

The invention provides methods, compositions, and apparatuses for preventing the formation of scale in heap leach process solution distribution systems comprised of piping, spray nozzels, or emitter tubes. Solution distribution system components often become fouled by scale because of local hot spots more prone to form scale than other locations along the systems length.
Ecolab Usa Inc.

Surface modification method and surface-modified body

Methods are provided for surface-modifying a rubber vulcanizate or a thermoplastic resin. The methods allow these objects to have a chemically fixed surface layer that exhibits not only low adsorption or selective adsorption properties with respect to proteins and cells, but also excellent durability, instead of having a coating which has drawbacks such as reduction in properties due to separation or peeling of the coating.
Sumitomo Rubber Industries, Ltd.

Rotating bed device for the separation by adsorption of at least one constituent of a gaseous mixture

A pressure swing absorption apparatus, including: at least four beds that each include an absorbent material, wherein the at least four beds are configured to rotate and are grouped such that members of one group only have fluid interconnections with members of another group; and a control system that controls a flow rate of a fluid communication between at least two of the beds by adjusting a phase angle difference between the at least two of the beds.. .

Method for removing bacteria from blood using high flow rate

The present invention provides methods for removing a significant amount of bacteria (e.g., gram-negative bacteria and gram-positive bacteria, including bacteria with no or low affinity for heparan sulfate) from whole blood, serum or plasma using an adsorption media. The method can be used in extracorporeal treatments involving high volumetric flow rates and high linear flow rates..
Exthera Medical Corporation

Prosthesis for in vivo insertion, coated with cross- linked polyphosphorylcholine

An in-vivo implantable prosthesis coated with crosslinked polyphosphoryicholine may be manufactured by a simple method of applying a coating composition including a photoinitiator, a crosslinking agent, and a phosphorylcholine (pc) monomer having an acrylate group according to the present invention, and then irradiating uv rays. The crosslinked polyphosphorylcholine coating may provide hydrophilicity for the surface and may also remarkably reduce adsorption of proteins and fibroblasts, which may cause side effects such as capsular contracture.

Method and argon recovery in a cryogenic air separation unit integrated with a pressure swing adsorption system

A method and apparatus for argon recovery in which an impure argon stream is separated from air within a cryogenic air separation unit having a divided wall argon rejection/rectification column. The resulting argon stream is subsequently recovered and purified within an integrated pressure swing adsorption system to produce product grade argon..

Method and argon recovery in a cryogenic air separation unit integrated with a pressure swing adsorption system

A method and apparatus for argon recovery in which an impure argon stream is separated from air within a cryogenic air separation unit having an argon rejection column and a reflux type argon condenser disposed internally within the lower pressure column. An impure argon stream is subsequently recovered from the argon rejection column and purified within an integrated adsorbent based argon refining and purification subsystem to produce product grade argon.

Method and increasing argon recovery in a cryogenic air separation unit integrated with a pressure swing adsorption system

A method and apparatus for increasing argon recovery in which an impure argon stream is separated from air within a cryogenic air separation unit and purified within an integrated, multi-stage pressure swing adsorption system to produce product grade argon with high argon recovery levels.. .

Method and argon recovery in a cryogenic air separation unit integrated with a pressure swing adsorption system

A method and apparatus for argon recovery in which an impure argon stream is separated from air within a cryogenic air separation unit having a divided wall argon rejection/rectification column. The resulting argon stream is subsequently recovered and purified within an integrated pressure swing adsorption system to produce product grade argon..

Fuel evaporative emission processing system

A fuel evaporative emission processing system suitable for a hybrid vehicle includes a fuel vapor passage, a shut-off valve, a purge passage, a first purge control valve, and a second purge control valve. The shut-off valve selectively opens and closes the fuel vapor passage communicating between a fuel tank and a canister.
Nissan Motor Co., Ltd.

Recovery useful resources in seawater and brine

Provided is a recovery method of useful resources in seawater and brine, and more particularly, a recovery method of useful resources in seawater and brine capable of improving adsorption efficiency and recovery efficiency of trace amounts of useful resources such as strontium, lithium, boron, or the like, present in brine at low cost by using a magnetic adsorbent composite and a solid-liquid separation process which uses magnetic force.. .
Korea Institute Of Geoscience And Mineral Resources

Probe reagent and fish using probe reagent

Provided are: a probe reagent which is capable of stably yielding a fluorescence signal in fish while inhibiting non-specific adsorption by the use of a nucleic acid molecule having a smaller number of bases than a bac probe; and fish using the probe reagent. The probe reagent is for in situ hybridization and comprises: phosphor-integrated nanoparticles containing phosphors integrated therein; and a nucleic acid molecule having a prescribed nucleic acid sequence, which phosphor-integrated nanoparticles and nucleic acid molecule are bound with each other..
Konica Minolta, Inc.

Pigment dispersion liquid, decorative material, transfer material for forming decorative material, substrate with decorative material, touch panel, information display device, and graft type silicone polymer

A pigment dispersion liquid includes a pigment dispersant; and a pigment, in which the pigment dispersant is a graft type silicone polymer denoted by general formula 1. In general formula 1, r1 to r10, r15 and r16 represent a hydrogen atom, a hydroxy group, an aryl group, or an alkyl group having 1 to 3 carbon atoms; r11 and r12 represent an arylene group or an alkylene group having 1 to 3 carbon atoms; y and z represent a single bond or a divalent organic linking group; a represents a group having a pigment adsorption portion; b represents a group having a structure denoted by general formula 2; 1 and n represent an integer of greater than or equal to 1; m represents an integer of greater than or equal to 0; and k represents an integer of greater than or equal to 1..
Fujifilm Corporation

Plasma processing apparatus

A sample stage includes a metallic electrode block to which high-frequency power is supplied from a high-frequency power supply, a dielectric heat generation layer which is disposed on a top surface of the electrode block and in which a film-like heater receiving power and generating heat is disposed, a conductor layer which is disposed to cover the heat generation layer, a ring-like conductive layer which is disposed to surround the heat generation layer at an outer circumferential side of the heat generation layer and contacts the conductor layer and the electrode block, and an electrostatic adsorption layer which is disposed to cover the conductor layer and electrostatically adsorbs a sample. The conductor layer and the ring-like conductive layer have dimensions more than a skin depth of a current of the high-frequency power and the electrode block is maintained at a predetermined potential during processing of the sample..
Hitachi High-technologies Corporation

Reconfigurable gas sensor architecture with a high sensitivity at low temperatures

A gas sensing device includes a dielectric substrate, a heater integrated into a first side of the substrate and an insulating dielectric formed over the heater. A gas sensing layer is formed on a second side of the substrate opposite the first side.
International Business Machines Corporation

Sample separator and sample separation/adsorption device

A sample separator (1) comprising an accommodation part (10) that accommodates a separation medium for electrophoresis, and a support (20) formed from a porous material. The accommodation part (10) includes an internal space (10c) filled with the separation medium, and is provided with a supply port (10a) and discharge port (10b) that are in communication with the internal space (10c).
Sharp Kabushiki Kaisha

Reconfigurable gas sensor architecture with a high sensitivity at low temperatures

A gas sensing device includes a dielectric substrate, a heater integrated into a first side of the substrate and an insulating dielectric formed over the heater. A gas sensing layer is formed on a second side of the substrate opposite the first side.
International Business Machines Corporation

Cylinder and adsorption separarion device using the cylinder

An adsorption separation device is used with a cylinder, wherein the cylinder comprises a cylinder body, a first piston, and a second piston. The first piston and the second piston are arranged inside the cylinder body, and the first piston and the second piston are be spaced from each other.
Shenzhen Biteman Science & Technology Co., Ltd.

Method of culturing pluripotent stem cell, and polypeptide to be used therefor

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by csyyqsc (seq id no:1) and an amino acid sequence represented by rgd; and (2) a second region containing (2-i) an amino acid sequence represented by prpslakkqrfrhrnrkgyrsqrghsrgrnqn (seq id no:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by seq id no:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by seq id no:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.. .
Fujifilm Corporation

Energy efficient ethanol recovery by adsorption

A method and system for recovering a volatile organic compound from a dilute aqueous phase. The method may include separating volatile organic compound from the aqueous phase by using carrier gas to generate a solvent-laden vapor stream, feeding a solvent-laden vapor stream to a mass of carbon adsorbent and enabling the solvent to be absorbed and separated from the solvent-laden vapor stream, releasing the absorbed volatile organic compound, and condensing the released volatile organic compound to form a condensate.
Joule Unlimited Technologies, Inc.

Porous carbon, manufacturing porous carbon, and adsorption/desorption apparatus using porous carbon

A porous carbon having a high oxidation reaction temperature, a method of manufacturing the porous carbon, and an adsorption/desorption apparatus using the porous carbon are provided. A porous carbon includes mesopores and a carbonaceous wall forming an outer wall of the mesopores, characterized by being composed mainly of hard carbon and having an oxidation reaction temperature of 600° c.
Toyo Tanso Co., Ltd.

Portable oxygen enrichment device and use

Lightweight, small, portable devices and methods are disclosed that provide oxygen-enriched air using an ultra rapid adsorption cycle based on advanced molecular sieve materials.. .
Separation Design Group Llc

Sour pressure swing adsorption process

Methods and apparatuses for separating co2 and sulfur-containing compounds from a synthesis gas obtained from gasification of a carbonaceous feedstock. The primary separating steps are performed using a sour pressure swing adsorption (spsa) system, followed by an acid gas enrichment system and a sulfur removal unit.
Air Products And Chemicals, Inc.

Functional light-transmissive material and manufacturing the same

The object of the present invention is to provide a novel functional light-transmissive material including tabular silver nanoparticles and the manufacturing of the same. According to the present invention, there is provided a functional light-transmissive material including: a transparent base material; an adsorption layer disposed on a surface of the transparent base material, wherein the adsorption layer contains a hydrophobic modified clay with organic compound; and tabular silver nanoparticles oriented and adsorbed on the adsorption layer.
Kuramoto Co., Ltd.

Reconfigurable gas sensor architecture with a high sensitivity at low temperatures

A gas sensing device includes a dielectric substrate, a heater integrated into a first side of the substrate and an insulating dielectric formed over the heater. A gas sensing layer is formed on a second side of the substrate opposite the first side.
International Business Machines Corporation

Oil-water separation treatment system and oil-water separation treatment method

An oil-water separation treatment system according to an embodiment of the present invention is an oil-water separation treatment system that separates a water-insoluble oil component from an oil-water mixed liquid, the system including an adsorption tower unit including at least one adsorption tower module, and a filtration unit including at least one filtration membrane module in that order. The adsorption tower module includes a tubular main body disposed vertically or horizontally, and a plurality of treatment layers which are divided from each other along an axial direction of the main body and in which a plurality of particles are enclosed.
Sumitomo Electric Industries, Ltd.

Isothermal co2 adsorption column

A new adsorbent co2-one for removal of acidic gases such as carbon dioxide and hydrogen sulfide was developed from hydrothermal reaction of natural limestone with natural kaolin via sodium hydroxide. Several synthesis conditions were employed such as initial concentration of naoh, weight ratio of limestone to kaolin, reaction temperature and pressure.
King Fahd University Of Petroleum And Minerals

Powder, producing powder, and adsorption apparatus

The present invention provides that powder is mainly constituted from secondary particles of hydroxyapatite. The secondary particles are obtained by drying a slurry containing primary particles of hydroxyapatite and aggregates thereof and granulating the primary particles and the aggregates.
Hoya Corporation

Method for operating an air-drying device for drying air, air-drying device for drying air as well as compressed air system

A method for operating an air-drying device (10) and an air-drying device (10) are provided. The air-drying device (10) has at least one adsorption device (20) with a first adsorption section (21), a second adsorption section (22), an air feed line (11), an air removal line and an analysis unit (13).
Drägerwerk Ag & Co. Kgaa

Oxygen sensor protection

An air separation system includes an air separation module configured to receive feed air and separate the feed air into nitrogen-enriched air and oxygen-enriched air, a nitrogen-enriched air line for transporting the nitrogen-enriched air from the air separation module to a fuel tank for inerting, an oxygen sensing line connected to the nitrogen-enriched air line, a gas adsorption filter located in the oxygen sensing line, and an oxygen sensor downstream of the gas adsorption filter in the oxygen sensing line.. .
Hamilton Sundstrand Corporation

Regulating flow of pressure swing adsorbers

A pressure swing adsorption (psa) system for purifying a feed gas is provided. The psa system may have a first adsorber bed and a second adsorber bed, each having a feed port, a product port, and adsorbent material designed to adsorb one or more impurities from the feed gas to produce a product gas.
Nuvera Fuel Cells, Llc



Adsorption topics:
  • Adsorption
  • Refrigerant
  • Circulation
  • Hydrocarbon
  • Hydrofluoroolefin
  • Frameworks
  • Activated Carbon
  • Steviol Glycosides
  • Rebaudioside
  • Crystallin
  • Critical Point
  • Liquid Fraction
  • Chromatograph
  • Scanning Electron Microscope
  • Electron Microscope


  • Follow us on Twitter
    twitter icon@FreshPatents

    ###

    This listing is a sample listing of patent applications related to Adsorption for is only meant as a recent sample of applications filed, not a comprehensive history. There may be associated servicemarks and trademarks related to these patents. Please check with patent attorney if you need further assistance or plan to use for business purposes. This patent data is also published to the public by the USPTO and available for free on their website. Note that there may be alternative spellings for Adsorption with additional patents listed. Browse our RSS directory or Search for other possible listings.


    1.5578

    file did exist - 2678

    2 - 1 - 56